PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_115846g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 1525aa    MW: 168861 Da    PI: 4.4062
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_115846g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-13550248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
   MA_115846g0010  5 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 50
                     78*****************************.************986 PP

2Myb_DNA-binding32.12.7e-1057100248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
   MA_115846g0010  57 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 100
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.223154IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-17254IPR009057Homeodomain-like
SMARTSM007177.0E-15352IPR001005SANT/Myb domain
PfamPF139217.7E-13767No hitNo description
CDDcd001673.63E-12750No hitNo description
SuperFamilySSF466891.87E-2030104IPR009057Homeodomain-like
CDDcd116595.29E-3152103No hitNo description
PROSITE profilePS5129416.44355104IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-1355101IPR009057Homeodomain-like
SMARTSM007171.7E-1255102IPR001005SANT/Myb domain
PfamPF118312.0E-58405652IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1525 aa     Download sequence    Send to blast
MIKGGVWKNT EDEILKAAVM KYGKNQWARI SSLLVRKSAK QCKARWYEWL DPSIKKTEWT  60
REEDEKLLHL AKLMPTQWRT IAPIVGRTPS QCLERYEKLL DAACVKDESY EPADDPRKLR  120
PGEIDPNPES KPARPDPVDM DEDEKEMLSE ARARLANTRG KKAKRKAREK QLEEARRLAS  180
LQKRRELKAA GIEGKQRRRK RKGIDYNAEI PFEKKPPAGF FDVSDEETRQ VEQPNFPTTI  240
EELEGKRRVD IEAQLRKQDV ARNKIMQRHD APSAVMQVNK LNDPEAVRKR AKLMLPSPQI  300
SDRELEEIAK MGYASDLVLG EDELAEGSGA ARALLANYGQ TPRLGMTPLR TPQRTPGGKG  360
DAIMMEAENQ ARLRESQTPL FGGENPELHP SDFSGVTPKK REIQTPNPIA TPMHTPGAVG  420
LTPRIGMTPS REFSMTPKGT PIRDELHINE GMETPDSSKA ESRRQAEIRR NLLAGLSDLP  480
VPKNEYQIVV PELPTEDIEV GYQMEEDMSD KLARERAEEA ARQAALLRKR SKVLQRDLPR  540
PPISSVDFIK NSLTRVDDDK GFVPTNFIEQ ADELIRKELV SLLEHDNAKY PFEEDSVKEK  600
KKGSKGAPNG RPQVPIPYID DFDVEELNEA AQLIEEEVSV LRVGMGHEDA SVDEFSEAHD  660
ACLEDMMYFP GRNSYGLGSV ASVTDKLAAT QNDFENVRNH MESETRKALR LEQKLKVLTQ  720
GYNMRAGKLW TQIEAAFKQA DTSGTELECF RSLHKQEQLA ASNRIEALRE AVNQQKEFER  780
QLQLRYQNLL VEQDNSQRHL QEQKEKMAHQ KEQENLQRLL KEQKEKMARQ KEQDNLERLL  840
QEQKEKLAHQ KDSRKENAID TQQSESAIAQ TDASHLENSS SEAQPFAISS KCNDVEMLDG  900
SGIAGEKTGE LDGSGIAEEK TERTGELDGS GIAEERTGEL DGSGIAEEKN GELDGSGIAE  960
EKNGELDGSG IAEEKNSELD GGSGIAEEKT GELDGSGIAE ERTGELDGSG IAEERTGELD  1020
GSGIAEEKNG ELDGSGIAEE KNGELDGSGI AEEKNSELDG GSGIAEEKTG ELDGSGIAKE  1080
KTDGSGIAEE KTGELDGSGI AEDKTSELDG SGIAEEKTSD NNSDMQIDCM PQSDGGHYNS  1140
DMQIDCVPQS DGHNNSDMQI DSVPQSDGHN PVLESEIVEQ NPHQTKDVMQ SDAKNIVVQD  1200
EKIVLQDENI DLITQSDGQN SVFRGDDVEQ VKHSTSLVAQ SDEQNDAIHN ESVEQVKNQQ  1260
ELADSSIYSQ NVINKDATTV SVEMQHPIQN STDGQNDAIH NENVLQLENQ QEAQALIYSQ  1320
NDINKDAAAV SVEMQPPIQN STDGQNDAIH NDNVLHVENQ QELAQPSIYS QNDINKDATG  1380
VSVAMQHPIQ NSTDGQNDAR YNENVGQVEN QQELAQSSTY SLIDINNDAA ALSVDMQQPI  1440
QNIDMVSSHG HLKEQLNDSD IQAQDVSAQT QQSVGDKTDT VMGVCKVTSQ EPVPLCTSDT  1500
EREIVVSTAQ VETAAAHTED VNLQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10112213236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1182201KRRELKAAGIEGKQRRRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006857301.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLU5DED60.0U5DED6_AMBTC; Uncharacterized protein
STRINGGSMUA_Achr9P23340_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP39481723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5